PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598832.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 683aa    MW: 75591 Da    PI: 6.9887
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598832.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.91.9e-32218274259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgy+WrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  d++++ei+Y+g Hnh+
  XP_009598832.1 218 DDGYTWRKYGQKHVKGSEFPRSYYKCTQQNCPVKKKVERSP-DGQITEIVYKGAHNHH 274
                     8****************************************.***************8 PP

2WRKY102.72e-32430488159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagCpv+k+ver+ ++   v++tYeg+Hnhe
  XP_009598832.1 430 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCPVRKHVERAPDNLISVITTYEGKHNHE 488
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.8E-28207275IPR003657WRKY domain
SuperFamilySSF1182908.89E-25214275IPR003657WRKY domain
SMARTSM007743.9E-36217275IPR003657WRKY domain
PfamPF031062.1E-25218274IPR003657WRKY domain
PROSITE profilePS5081122.814218276IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-35415490IPR003657WRKY domain
SuperFamilySSF1182903.14E-28423490IPR003657WRKY domain
PROSITE profilePS5081136.472425490IPR003657WRKY domain
SMARTSM007745.5E-38430489IPR003657WRKY domain
PfamPF031061.4E-25431488IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MERNIGEPID DWNFQIVENL DSETMLDTHE SAVKVEERSG NAENGSLFPN NNNKRSSIAE  60
RRAAKCGFNA STISIAQFRV TTTSTPEMSP PTARPNFLTI PPGLTPAALL DSPVMLPNSL  120
APQSPTTGSF HFSTINQENT MKTTQIARDH FEFPVESPKA TALKKCSLDI ACETNVQQNM  180
SCIGLTNIHE SGNCARRANQ FEQRSAVTSN NITCNGSDDG YTWRKYGQKH VKGSEFPRSY  240
YKCTQQNCPV KKKVERSPDG QITEIVYKGA HNHHKSQPPR RATMSSTVYG LGETSEMSEG  300
NIGGSNSWRS VQFERNKDVR APSGLDRTSS ASVLTKVSDP LMLNYQKTNI NAFESAGTTP  360
EPSSTLASRD DEDEDRATEG STSLGDDVDD YAFDHKRRRR EFYSVETSLS SRTTREPRVV  420
VQIESEIDIL DDGYRWRKYG QKVVKGNPNP RSYYKCTSAG CPVRKHVERA PDNLISVITT  480
YEGKHNHEVP SANKTNCAIS GNQALTSTSK THKVSNLGMQ VQDCNFQFNR KPFDYVRPSF  540
LDLRFGATSP IYDLKFPTNL HSYGSFLLSP TQVSNSCSFA PLQMPEFPLP LSLPMSLPLV  600
GPNIVPPLGG FHFNDLPLTP NGVSSHSSIA VGDQKYIHDD NNNNKNAIIV RGNEEIKNEN  660
LCDHQNGASS AVLCGQIMDN FPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-31218491878Probable WRKY transcription factor 4
2lex_A5e-31218491878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR5596780.0KR559678.1 Nicotiana benthamiana WRKY transcription factor (WRKY79) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598832.10.0PREDICTED: probable WRKY transcription factor 33 isoform X1
TrEMBLA0A0V0ITX20.0A0A0V0ITX2_SOLCH; Putative WRKY transcription factor 2-like
STRINGSolyc04g056360.2.11e-139(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57672237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-87WRKY DNA-binding protein 2